top of page

CircRNA

Gene

chr2|53866084|53928303|-|36|circRNA|PSME4|ENST00000404125.5|46,45,44,43,42,41,40,39,38,37,36,35,34,33,32,31,30,29,28,27,26,25,24,23,22,21,20,19,18,17,16,15,14,13,12,11

PSME4

Open Reading Frame (ORF)

MTTGRNINSNSLMTNCLFSPIFLCHHAIMHRKNISCIRDINRTSPAHSYFKLCNWSSPQFGIRRQMVS

Peptide

LCNWSSPQFGIR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page