top of page

CircRNA

Gene

chr2|47373462|47374048|+|2|circRNA|EPCAM|ENST00000405271.5|3,4

EPCAM

Open Reading Frame (ORF)

MAQNLGEEQNLKGPSRTMMGFMILTAMRAGSLRPSSATAPPCAGV

Peptide

TMMGFMILTAMRAGSLRPSSATAPPCAGV

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

29

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page