top of page

CircRNA

Gene

chr2|42770205|42770492|-|1|ciRNA|HAAO|ENST00000294973.10|5

HAAO

CircRNA UID

ciHAAO(5)

Open Reading Frame (ORF)

LLSWGSASAPDALGESLPSQGGDPGPESPLPGRGEGGAAAPLGGKGWQTHSCVRAP

Peptide

GEGGAAAPLGGK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page