top of page

CircRNA

Gene

chr2|42695764|42723035|+|7|circRNA|MTA3|ENST00000405592.5|11,12,13,14,15,16,17

MTA3

Open Reading Frame (ORF)

LQTPTTKRMLTTPNHTSLSILGKRNYSHHNGLDASLEIID

Peptide

NYSHHNGLDASLEIID

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page