top of page

CircRNA

Gene

chr2|37279745|37286369|—|3|circRNA|PRKD3|ENST00000379066.5|8,7,6

PRKD3

Open Reading Frame (ORF)

MTQKSHHPQKIRCSSWIHLISMWKEMKKPLKQSVTCPPGTK

Peptide

KPLKQSVTCPPGTK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page