top of page

CircRNA

Gene

chr2|37269614|37317179|—|12|circRNA|PRKD3|ENST00000379066.5|13,12,11,10,9,8,7,6,5,4,3,2

PRKD3

Open Reading Frame (ORF)

LVVFLQTRLLFDGTDIKRNRTFGAFNSLIKLKSIGMSGLTEEIKKFSTKSKSAVIFFTAVILKTSS

Peptide

LLFDGTDIKR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page