top of page

CircRNA

Gene

chr2|37122505|37135546|—|3|circRNA|EIF2AK2|ENST00000233057.8|12,11,10

EIF2AK2

Open Reading Frame (ORF)

LFTTMAVGMDLIMILRPVMILLRAVIMILRTAKIVQDLWHPDLTFLT

Peptide

AVIMILR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page