top of page

CircRNA

Gene

chr2|37049652|37058987|-|6|circRNA|HEATR5B|ENST00000233099.5|18,17,16,15,14,13

HEATR5B

Open Reading Frame (ORF)

LTLVMGPLDNPNPILRCAAGEALGRMAQVVGEATFIARMAQYSFDNHEELRCTLS

Peptide

MAQVVGEATFIARMAQYSFDNHEELR

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page