top of page

CircRNA

Gene

chr2|37037854|37041292|—|3|circRNA|HEATR5B|ENST00000233099.5|21,20,19

HEATR5B

Open Reading Frame (ORF)

LVGCAITQDHSDSLVQAAAISCLQQLHMFAPRHVNLSSLVPSLCVEIGSRCCI

Peptide

HVNLSSLVPSLCVEIGSR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page