top of page

CircRNA

Gene

chr2|37003541|37007304|-|3|circRNA|HEATR5B|ENST00000233099.5|31,30,29

HEATR5B

CircRNA UID

circHEATR5B(31,30,29)

Open Reading Frame (ORF)

LESIICPAVGYWSCTTDSKSCSGLFAREKKHSKWSILYP

Peptide

LESIICPAVGYWSCTTDSK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page