top of page

CircRNA

Gene

chr2|33360596|33365503|+|5|circRNA|LTBP1|ENST00000404816.6|27,28,29,30,31

LTBP1

Open Reading Frame (ORF)

LLSVWRGLGHAVCPLPPEGFRFRCRCRSTQRRKERMLL

Peptide

GLGHAVCPLPPEGFRFR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page