top of page

CircRNA

Gene

chr2|33257442|33293282|+|9|circRNA|LTBP1|NM_001166265|8,9,10,11,12,13,14,15,16

LTBP1

Open Reading Frame (ORF)

MWTSAWNQTSAQMVIVPTLKAPTCVHATKAIPGLRTTSTVEPRKSQWRP

Peptide

AIPGLRTTSTVEPR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page