top of page

CircRNA

Gene

chr2|33134792|33293282|+|16|circRNA|LTBP1|ENST00000404816.6|5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20

LTBP1

Open Reading Frame (ORF)

MWTSAWNQTSAQMVIVPTLKAPTCVHATKAIPGLRTTSTVE

Peptide

APTCVHATK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page