top of page

CircRNA

Gene

chr2|32439507|32477583|+|20|circRNA|BIRC6|NM_016252|16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35

BIRC6

CircRNA UID

circBIRC6(16,17,18,19,20,21,22,23,24,25,26,27,28,29,30,31,32,33,34,35)

Open Reading Frame (ORF)

LFCFFSPWTLHVMQISYCLFVRYGRRKISFVFNPCQGSE

Peptide

LFCFFSPWTLHVMQISYCLFVRYGR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page