top of page

CircRNA

Gene

chr2|32377587|32401385|+|6|circRNA|BIRC6|NM_016252|2,3,4,5,6,7

BIRC6

Open Reading Frame (ORF)

MCHCQSLLQQVLHSFLVRMELTEYLALGRGAALIF

Peptide

MELTEYLALGR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page