top of page

CircRNA

Gene

chr2|28776850|28788809|+|5|circRNA|PPP1CB|ENST00000358506.6|3,4,5,6,7

PPP1CB

CircRNA UID

circPPP1CB(3,4,5,6,7)

Open Reading Frame (ORF)

LLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQYEDVVQERLCR

Peptide

AHQYEDVVQER

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page