top of page

CircRNA

Gene

chr2|27366758|27367201|—|2|circRNA|EIF2B4|NM_172195|10,9

EIF2B4

Open Reading Frame (ORF)

LDRGPAVSGGSGGQPAMAGRKAHTTFSSPCWCPSLLPADSCSLLCAPRGQVRTSSSH

Peptide

GPAVSGGSGGQPAMAGRK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page