top of page

CircRNA

Gene

chr2|26232159|26234355|—|2|circRNA|HADHA|ENST00000380649.7|6,5

HADHA

Open Reading Frame (ORF)

LLGALPGAGGTQRLPKMHVSRLQDPSRSNTAITRSTENS

Peptide

MHVSRLQDPSR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page