top of page

CircRNA

Gene

chr2|25300138|25314161|—|2|circRNA|DNMT3A|ENST00000264709.7|3,2

DNMT3A

Open Reading Frame (ORF)

LGGSASTPRWSHRSPHPQADRGTVHQRAQHRDLCLSFNSRLQRPR

Peptide

LGGSASTPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page