top of page

CircRNA

Gene

chr2|241748864|241756014|+|5|circRNA|D2HGDH|ENST00000436747.5|7,8,9,10,11

D2HGDH

Open Reading Frame (ORF)

LARFCFSHQHRLLLLRILPPPWPARRVPPPPRPAHRVLPSPVAHPPCPSLPCGPPAMSLPPTRHAP

Peptide

ILPPPWPARR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page