top of page

CircRNA

Gene

chr2|241632916|241634079|-|1|circRNA|THAP4|NM_015963|2

THAP4

CircRNA UID

circTHAP4(2)

Open Reading Frame (ORF)

MWNQAAVGAAWDPTRAWPRALPAHHLPRHRRSLPRAPLPLLPTSPQSQPRKPCRASTATPAPCPSTRSSCRRQGPASSSTHCTPTASPPGRTRARCAACGSRWRRRTAS

Peptide

ASTATPAPCPSTRSSCR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page