top of page

CircRNA

Gene

chr2|241403827|241418109|+|6|circRNA|FARP2|ENST00000264042.7|3,4,5,6,7,8

FARP2

CircRNA UID

circFARP2(3,4,5,6,7,8)

Open Reading Frame (ORF)

LLSRISRCSKLLESWKCTASDFTWLLTGKEPRFNWQFPTWVYSCSSLNAMARYY

Peptide

FNWQFPTWVYSCSSLNAMARYY

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page