top of page

CircRNA

Gene

chr2|241403827|241413421|+|5|circRNA|FARP2|ENST00000264042.7|3,4,5,6,7

FARP2

CircRNA UID

circFARP2(3,4,5,6,7)

Open Reading Frame (ORF)

LDREHLKVNEYLPGQQHCLEKILEFHQKHVLNAMARYY

Peptide

ILEFHQKHVLNAMAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page