top of page

CircRNA

Gene

chr2|241373083|241418109|+|7|circRNA|FARP2|ENST00000264042.7|2,3,4,5,6,7,8

FARP2

CircRNA UID

circFARP2(2,3,4,5,6,7,8)

Open Reading Frame (ORF)

LLSRISRCSKLLESWKCTASDFTWLLTGKEPRFNWQFPTWVYSCSSVFFTHGEEWGR

Peptide

CTASDFTWLLTGKEPR

ORF Found in Long-Read

true

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page