top of page

CircRNA

Gene

chr2|241140520|241140753|—|1|circRNA|PASK|ENST00000234040.8|3

PASK

Open Reading Frame (ORF)

LPRIFVQVNCTALLPLSTRTRPNRGAVCPAAPCCGDCPQGGPHLCFRPLCATLTRPSSRWMPRPQRRQMELLLSIITGCPEYLYK

Peptide

RQMELLLSIITGCPEYLYK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page