top of page

CircRNA

Gene

chr2|241089187|241094432|-|3|circRNA|MTERF4|ENST00000464344.6|4,3,2

MTERF4

Open Reading Frame (ORF)

LLPKGASLICATRKMNCEGSYKGQEEQSCPRPTRDSSFMQ

Peptide

MNCEGSYKGQEEQSCPRPTR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page