top of page

CircRNA

Gene

chr2|239102775|239115310|-|4|circRNA|HDAC4|ENST00000345617.7|16,15,14,13

HDAC4

Open Reading Frame (ORF)

LEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLDHPQAKRASPAAGEPPGGDGGGAP

Peptide

ASPAAGEPPGGDGGGAP

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page