top of page

CircRNA

Gene

chr2|234995302|235043247|+|3|circRNA|SH3BP4|ENST00000392011.6|2,3,4

SH3BP4

Open Reading Frame (ORF)

LCPKDAPGQRGHTPGTQPCPGGPAAVGEAPVRFVQAPGSQGLYVFQYDELRGQSQRAGQSGARIPAEAGQGEPPDLPHHLPEPQRAL

Peptide

GQSQRAGQSGAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page