top of page

CircRNA

Gene

chr2|229818363|229829288|—|2|circRNA|TRIP12|NM_001284215|7,6

TRIP12

Open Reading Frame (ORF)

MKVNSFRQLLRCVSYWSWEMRRHWEGFLSRVLFQLCFVRGKGSSPSPIWSSWSSDVTAFP

Peptide

HWEGFLSRVLFQLCFVR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page