top of page

CircRNA

Gene

chr2|223765212|223777869|-|3|circRNA|AP1S3|ENST00000443700.5|4,3,2

AP1S3

Open Reading Frame (ORF)

LLSKPLKTLICYRRYISYCSSVDKGNYGYRNGTSLSLIKRGRRSPGKLFRLFSPVVTGQAVLLTGRS

Peptide

SPGKLFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page