top of page

CircRNA

Gene

chr2|222630112|222634541|—|4|circRNA|FARSB|ENST00000281828.6|9,8,7,6

FARSB

Open Reading Frame (ORF)

LILLSPCSVNIVRINLRKEHWLPLVPMIWTLCRAHLLILQSVLQISNSSL

Peptide

LILLSPCSVNIVRINLR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page