top of page

CircRNA

Gene

chr2|219566829|219568324|—|4|circRNA|OBSL1|NM_015311|5,4,3,2

OBSL1

Open Reading Frame (ORF)

MCRYTTGKMPSSPSISPPSSRVPGSLMGKSSRVTSRRARWNLGPCGTV

Peptide

YTTGKMPSSPSISPPSSR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page