top of page

CircRNA

Gene

chr2|219451135|219464608|+|5|circRNA|SPEG|ENST00000312358.11|5,6,7,8,9

SPEG

Open Reading Frame (ORF)

LRRRLRVGCAGCGSWLQSVAMLVSTLAKRSMSMVLGSARPAWRSESLRMTPTCPLEKSP

Peptide

RSMSMVLGSARPAWR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page