top of page

CircRNA

Gene

chr2|218737578|218740584|+|3|circRNA|TTLL4|NM_014640|3,4,5

TTLL4

CircRNA UID

circTTLL4(3,4,5)

Open Reading Frame (ORF)

LLAFEPVRKKPFFSPSKEPPCQSHCQQGHFFHGLLHGPAHGLLIHRTIPLLGSGWGKPFREEPGLCHLREDPISTLFLL

Peptide

EEPGLCHLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page