top of page

CircRNA

Gene

chr2|218660938|218662260|+|4|circRNA|BCS1L|ENST00000359273.7|2,3,4,5

BCS1L

CircRNA UID

circBCS1L(2,3,4,5)

Open Reading Frame (ORF)

MGPLVAERAVLCFRNTPGPVRFGVSLSRCHFQTLFWL

Peptide

FGVSLSR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page