top of page

CircRNA

Gene

chr2|216414646|216420532|+|3|circRNA|SMARCAL1|NM_014140|3,4,5

SMARCAL1

Open Reading Frame (ORF)

MVSFSSNRISVAHLMLTKDLMIPTVFRQREYGKSQKKCPQPAQATVHVVKWLSLESLLPWHKVLQRSLNNSS

Peptide

ISVAHLMLTKDLMIPTVFR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page