top of page

CircRNA

Gene

chr2|215376677|215378174|-|1|ciRNA|FN1|ENST00000421182.5|33

FN1

CircRNA UID

ciFN1(33)

Open Reading Frame (ORF)

MTVIFYTPSERGLLTHKMESLHKLIMLILWTMTDI

Peptide

GLLTHKMESLHK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page