top of page

CircRNA

Gene

chr2|210031466|210032924|+|2|circRNA|AC007038.7|NR_110291|2,3

AC007038.7

CircRNA UID

circAC007038.7(2,3)

Open Reading Frame (ORF)

LSITASMMSIENSKNLNTNTIKKEVQTTSGRTISRNNEAFMEYRLATL

Peptide

LSITASMMSIENSK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page