top of page

CircRNA

Gene

chr2|208335305|208348023|+|11|circRNA|PIKFYVE|ENST00000264380.8|25,26,27,28,29,30,31,32,33,34,35

PIKFYVE

CircRNA UID

circPIKFYVE(25,26,27,28,29,30,31,32,33,34,35)

Open Reading Frame (ORF)

LECCPSSEGQQGKAPISLPRRERPYVEQIVLTTRLGRRARRGPRIKALSLKLFSHSAS

Peptide

APISLPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page