top of page

CircRNA

Gene

chr2|208271510|208285933|+|5|circRNA|PIKFYVE|NM_001178000|2,3,4,5,6

PIKFYVE

CircRNA UID

circPIKFYVE(2,3,4,5,6)

Open Reading Frame (ORF)

LNALSDSACSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQRLMKWPQMIRRPQHWTLLMICLDLLLVLLISHTLNL

Peptide

LMKWPQMIR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page