top of page

CircRNA

Gene

chr2|207088457|207124404|—|2|circRNA|KLF7|ENST00000412414.6|3,2

KLF7

Open Reading Frame (ORF)

LRGPLRVDRATVTKEGWGLKHVPKTRRGFTAVSLTGAGKFIQKAPT

Peptide

VDRATVTK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page