top of page

CircRNA

Gene

chr2|199368604|199456096|—|5|circRNA|SATB2|ENST00000417098.5|6,5,4,3,2

SATB2

Open Reading Frame (ORF)

MPMCQQPSARSLGDGIKSTRRLKVPVRFIATCRWELCLRVGAAWSGGARARVCGTAPTGGAAARTSRGLPQ

Peptide

ARVCGTAPTGGAAAR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page