top of page

CircRNA

Gene

chr2|197408368|197418588|—|4|circRNA|SF3B1|ENST00000335508.10|8,7,6,5

SF3B1

Open Reading Frame (ORF)

LGMEVDGLRLLEQIEVEILLVKHRLLEPVKENHGGMKHQLVRWVEALQF

Peptide

LGMEVDGLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page