top of page

CircRNA

Gene

chr2|196719496|196732152|+|9|circRNA|CCDC150|ENST00000431807.6|14,15,16,17,18,19,20,21,22

CCDC150

Open Reading Frame (ORF)

LGKTGGRKRWETFSDNWQKLKKTTAKSQSCWRMCWLLTVRCKVLWRKYK

Peptide

LGKTGGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page