top of page

CircRNA

Gene

chr2|191414047|191416242|+|3|circRNA|MYO1B|ENST00000339514.8|26,27,28

MYO1B

Open Reading Frame (ORF)

LKWPPSSIAQLSAKPNRSSILRFPMMLGNHSKGLTWKSTRTPSIRNSKMPLKKRSSLLKS

Peptide

FPMMLGNHSK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page