top of page

CircRNA

Gene

chr2|190659157|190670459|+|2|circRNA|NAB1|ENST00000409581.5|2,3

NAB1

Open Reading Frame (ORF)

LVSPDSGKATMPLRASTASPQQTWAPPRPQRRAVRRWMLLLRSLWLSVWSGWPPHCQKVT

Peptide

RWMLLLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page