top of page

CircRNA

Gene

chr2|17720939|17745951|—|9|circRNA|SMC6|ENST00000448223.6|11,10,9,8,7,6,5,4,3

SMC6

Open Reading Frame (ORF)

MPSEIISKLEKIVLLDLTGKWKNSRPDGQKKGRKFFLS

Peptide

IVLLDLTGK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page