top of page

CircRNA

Gene

chr2|174123594|174142000|—|2|circRNA|OLA1|NM_001011708|5,4

OLA1

Open Reading Frame (ORF)

MCKVKSWVIDQKKPVRFYHDWNDKEVLLKMMISRTLKEV

Peptide

EVLLKMMISR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page