top of page

CircRNA

Gene

chr2|173913069|173918785|—|2|circRNA|SP3|NM_001017371|4,3

SP3

Open Reading Frame (ORF)

LENALLFVTGCTVVKDLLEVMNYRGTEEHIQILGSRKKNLILKSGSSVVILP

Peptide

DLLEVMNYR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page