top of page

CircRNA

Gene

chr2|168873584|168877384|-|3|circRNA|SPC25|ENST00000479309.6|4,3,2

SPC25

CircRNA UID

circSPC25(4,3,2)

Open Reading Frame (ORF)

LTLRILRAHLCFPYISMKQGTMKRSAGKISSFKKKRITC

Peptide

ILRAHLCFPYISMK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page